PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr10P22610_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family GRAS
Protein Properties Length: 442aa    MW: 49851.1 Da    PI: 8.1308
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr10P22610_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS88.88.8e-281912961109
                    GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsev 87 
                             l++lL+ cA+av+++d + a++lL+++++++sp+gd  qRla++f+ +L+arla+++s++y+al +++t+    +++l+a++l+  +
  GSMUA_Achr10P22610_001 191 LRTLLILCAQAVAADDRRTANELLKQIRQHSSPHGDGSQRLAHCFADGLEARLAGTGSQIYHALVAKRTT---ATDVLKAYHLYLAA 274
                             5789*************************************************************99999...99************ PP

                    GRAS  88 sPilkfshltaNqaIleavege 109
                             +P+ ++sh+  Nq+Il+ ++++
  GSMUA_Achr10P22610_001 275 CPFKRISHFFSNQTILNLADKA 296
                             ****************998876 PP

2GRAS482.1e-15303366154218
                    GRAS 154 skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesv 218
                              +e++eetg+rLa++A++++vpfe+++ +a+++e++++e+L++ ++E+++Vn+ ++  +l de++
  GSMUA_Achr10P22610_001 303 PTERIEETGRRLADYAKSFNVPFEYQA-IASKWETIRVEDLHIAKDEVVVVNCLYRFRNLIDETG 366
                             6789***********************.7*****************************9999875 PP

3GRAS58.21.8e-18359438295374
                    GRAS 295 vnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                             +n++   g er+er et+++W+ r  +aGF +++ + +++k+ak  ++ ++ + + ++e+ g+l++gWk+r ++++SaW+
  GSMUA_Achr10P22610_001 359 RNLIDETGPERVERPETYKQWQVRNLRAGFVQLRPNPDIMKKAKDKVKGCYHKDFVIDEDGGWLIQGWKGRIVYAISAWK 438
                             6999***********************************************889*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098517.487165442IPR005202Transcription factor GRAS
PfamPF035143.0E-25191296IPR005202Transcription factor GRAS
PfamPF035146.2E-16359438IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 442 aa     Download sequence    Send to blast
MEEDIDEKIS TYKEESALRA AEKPFYDILG QKYPPSPDRP PPINIYQSSE SPYERSSNHD  60
SSDNQHSRAH AGSVDYSPQT PSSSSNSVSS SIEEPFNNVS ISPNLFFGSV PAWHFKRGVE  120
EARKFLPIND KLVINLESND DLDLAEGRSN KQSAVSSQEE VRSEMFDMVL LCSSGGKARG  180
KKQTKKEVVD LRTLLILCAQ AVAADDRRTA NELLKQIRQH SSPHGDGSQR LAHCFADGLE  240
ARLAGTGSQI YHALVAKRTT ATDVLKAYHL YLAACPFKRI SHFFSNQTIL NLADKASKPG  300
FRPTERIEET GRRLADYAKS FNVPFEYQAI ASKWETIRVE DLHIAKDEVV VVNCLYRFRN  360
LIDETGPERV ERPETYKQWQ VRNLRAGFVQ LRPNPDIMKK AKDKVKGCYH KDFVIDEDGG  420
WLIQGWKGRI VYAISAWKPK GA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009380633.10.0PREDICTED: scarecrow-like protein 9
SwissprotQ9XE585e-89SCL14_ARATH; Scarecrow-like protein 14
TrEMBLM0RKI60.0M0RKI6_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr10P22610_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP150538118
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-83SCARECROW-like 14